PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400047208
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family GATA
Protein Properties Length: 255aa    MW: 28905.2 Da    PI: 9.9425
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400047208genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA627.1e-20188221134
                  GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                           C++Cg+ kTp+WR gp g+ktLCnaCG++y++ +
  PGSC0003DMP400047208 188 CQHCGVDKTPQWRAGPTGPKTLCNACGVRYKSGR 221
                           *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011412.479182218IPR000679Zinc finger, GATA-type
SMARTSM004015.4E-17182232IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.66E-15184245No hitNo description
Gene3DG3DSA:3.30.50.102.3E-15185219IPR013088Zinc finger, NHR/GATA-type
CDDcd002023.50E-14187236No hitNo description
PROSITE patternPS003440188213IPR000679Zinc finger, GATA-type
PfamPF003201.1E-17188221IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MNVYFELLIR VALSKTTSTT ILLKAQTRLM RLHWICCCCC YMLGRVLTEY VLQDYVEEEL  60
EWLSNKDAFP AVEFDIFSDH VPNVIFDHHS PNSVLENSSS NNNNNNNCNV NVKKNAFTSH  120
TSSLLQVPIN HPVGARSKRR RRIALQCDNS CVWGNQVKFN NTSTKQGLTL LKISMTKAKR  180
GTSIGRRCQH CGVDKTPQWR AGPTGPKTLC NACGVRYKSG RLFPEYRPAN SPTFSVDLHS  240
SSHRKVLEMR KQRI*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1137142KRRRRI
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00377DAPTransfer from AT3G24050Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754440.0HG975444.1 Solanum pennellii chromosome ch05, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006355741.11e-150PREDICTED: GATA transcription factor 1-like
TrEMBLM1CLA10.0M1CLA1_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000698650.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA40762445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24050.19e-43GATA transcription factor 1
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]